SCOPe 2.05: Structural Classification of Proteins

PDB entry 4s1f

View 4s1f on RCSB PDB site
Description: Fructose-6-phosphate aldolase A from E.coli soaked in acetylacetone
Class: lyase
Keywords: Modification of active Lys85 by acetylacetone, Tim barrel, homodecamer, lyase, Fructose-6-phosphate aldolase A, Cytosol
Deposited on 2015-01-13, released 2015-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fa_
Chain 'B':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fb_
Chain 'C':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fc_
Chain 'D':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fd_
Chain 'E':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fe_
Chain 'F':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1ff_
Chain 'G':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fg_
Chain 'H':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fh_
Chain 'I':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fi_
Chain 'J':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fj_
Chain 'K':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fk_
Chain 'L':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fl_
Chain 'M':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fm_
Chain 'N':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fn_
Chain 'O':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fo_
Chain 'P':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fp_
Chain 'Q':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fq_
Chain 'R':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fr_
Chain 'S':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1fs_
Chain 'T':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
Domains in SCOPe 2.05: d4s1ft_
Heterogens: P2D, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4s1fA (A:)
mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi