PDB entry 4s1f

View 4s1f on RCSB PDB site
Description: Fructose-6-phosphate aldolase A from E.coli soaked in acetylacetone
Class: lyase
Keywords: Modification of active Lys85 by acetylacetone, Tim barrel, homodecamer, lyase, Fructose-6-phosphate aldolase A, Cytosol
Deposited on 2015-01-13, released 2015-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fa1, d4s1fa2
  • Chain 'B':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fb1, d4s1fb2
  • Chain 'C':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fc1, d4s1fc2
  • Chain 'D':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fd1, d4s1fd2
  • Chain 'E':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fe1, d4s1fe2
  • Chain 'F':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1ff1, d4s1ff2
  • Chain 'G':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fg1, d4s1fg2
  • Chain 'H':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fh1, d4s1fh2
  • Chain 'I':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fi1, d4s1fi2
  • Chain 'J':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fj1, d4s1fj2
  • Chain 'K':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fk1, d4s1fk2
  • Chain 'L':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fl1, d4s1fl2
  • Chain 'M':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fm1, d4s1fm2
  • Chain 'N':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fn1, d4s1fn2
  • Chain 'O':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fo1, d4s1fo2
  • Chain 'P':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fp1, d4s1fp2
  • Chain 'Q':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fq1, d4s1fq2
  • Chain 'R':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fr1, d4s1fr2
  • Chain 'S':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1fs1, d4s1fs2
  • Chain 'T':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (7-225)
      • expression tag (6)
    Domains in SCOPe 2.07: d4s1ft1, d4s1ft2
  • Heterogens: P2D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4s1fA (A:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fA (A:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4s1fB (B:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fB (B:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4s1fC (C:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fC (C:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4s1fD (D:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fD (D:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4s1fE (E:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fE (E:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4s1fF (F:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fF (F:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4s1fG (G:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fG (G:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4s1fH (H:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fH (H:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4s1fI (I:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fI (I:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4s1fJ (J:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fJ (J:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4s1fK (K:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fK (K:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4s1fL (L:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fL (L:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4s1fM (M:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fM (M:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4s1fN (N:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fN (N:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4s1fO (O:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fO (O:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4s1fP (P:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fP (P:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4s1fQ (Q:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fQ (Q:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4s1fR (R:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fR (R:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4s1fS (S:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fS (S:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4s1fT (T:)
    mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
    rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
    aqgllsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
    dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1fT (T:)
    helyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
    mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
    alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
    cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi