PDB entry 4s1d

View 4s1d on RCSB PDB site
Description: Structure of IgG1 Fab fragment in complex with Biotincytidinamide
Class: immune system
Keywords: Antibody, Fab fragment, hapten, MAB_M33_FAB_FRAGMENT, IMMUNE SYSTEM
Deposited on 2015-01-13, released 2015-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: MAB M33 FAB FRAGMENT, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4S1D (Start-219)
  • Chain 'D':
    Compound: MAB M33 FAB FRAGMENT, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4S1D (0-End)
    Domains in SCOPe 2.07: d4s1dd1, d4s1dd2
  • Chain 'E':
    Compound: MAB M33 FAB FRAGMENT, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4S1D (0-End)
  • Chain 'F':
    Compound: MAB M33 FAB FRAGMENT, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4S1D (0-End)
    Domains in SCOPe 2.07: d4s1df1, d4s1df2
  • Chain 'H':
    Compound: MAB M33 FAB FRAGMENT, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4S1D (0-219)
  • Chain 'L':
    Compound: MAB M33 FAB FRAGMENT, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4S1D (0-End)
    Domains in SCOPe 2.07: d4s1dl1, d4s1dl2
  • Chain 'O':
    Compound: MAB M33 FAB FRAGMENT, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4S1D (0-219)
  • Chain 'P':
    Compound: MAB M33 FAB FRAGMENT, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4S1D (0-End)
    Domains in SCOPe 2.07: d4s1dp1, d4s1dp2
  • Heterogens: 41M, SO4, HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4s1dD (D:)
    diqmtqspaslsasvgetvtitcrasgnihnylswfqqkqgkspqllvysaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyycqhfwssiytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1dD (D:)
    diqmtqspaslsasvgetvtitcrasgnihnylswfqqkqgkspqllvysaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyycqhfwssiytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4s1dF (F:)
    diqmtqspaslsasvgetvtitcrasgnihnylswfqqkqgkspqllvysaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyycqhfwssiytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1dF (F:)
    diqmtqspaslsasvgetvtitcrasgnihnylswfqqkqgkspqllvysaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyycqhfwssiytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4s1dL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylswfqqkqgkspqllvysaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyycqhfwssiytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1dL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylswfqqkqgkspqllvysaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyycqhfwssiytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4s1dP (P:)
    diqmtqspaslsasvgetvtitcrasgnihnylswfqqkqgkspqllvysaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyycqhfwssiytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1dP (P:)
    diqmtqspaslsasvgetvtitcrasgnihnylswfqqkqgkspqllvysaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyycqhfwssiytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfn