PDB entry 4s0t

View 4s0t on RCSB PDB site
Description: structure of human pregnane x receptor ligand binding domain bound with adnectin-1 and compound-1
Class: transcription
Keywords: nuclear receptor, multiple binding modes, xenobiotic, promiscuous, nuclear hormone receptor, transcription
Deposited on 2015-01-05, released 2015-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3.14 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 1 group I member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1I2, PXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4s0ta_
  • Chain 'B':
    Compound: Nuclear receptor subfamily 1 group I member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1I2, PXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4s0tb_
  • Chain 'D':
    Compound: Adnectin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4S0T
    Domains in SCOPe 2.07: d4s0td_
  • Chain 'E':
    Compound: Adnectin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4S0T
    Domains in SCOPe 2.07: d4s0te_
  • Heterogens: 40U

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4s0tA (A:)
    mkkhhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvls
    sgcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifsl
    lphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgtw
    ecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqh
    rvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdihp
    fatplmqelfgitgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s0tA (A:)
    lteeqrmmirelmdaqmktfdttfshfknfrlpgveslqapsreeaakwsqvrkdlcslk
    vslqlrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpie
    dqisllkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqlllepmlkfhyml
    kklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflf
    lkimamltelrsinaqhtqrllriqdihpfatplmqelf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4s0tB (B:)
    mkkhhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvls
    sgcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifsl
    lphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgtw
    ecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqh
    rvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdihp
    fatplmqelfgitgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s0tB (B:)
    glteeqrmmirelmdaqmktfdttfshfknfrlpgvleslqapsreeaakwsqvrkdlcs
    lkvslqlrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlp
    iedqisllkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqlllepmlkfhy
    mlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrf
    lflkimamltelrsinaqhtqrllriqdihpfatplmqelfgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4s0tD (D:)
    mastsgsthyykqtadlevvaatptslliswpppyyvegvtvfritygetggnspvqeft
    vpywtetatisglkpgvdytitvyaemypgspwagqvmdiqpisinyrtegsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s0tD (D:)
    adlevvaatptslliswpppyyvegvtvfritygetggnspvqeftvpywtetatisglk
    pgvdytitvyaemypgspwmdiqpisinyrt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4s0tE (E:)
    mastsgsthyykqtadlevvaatptslliswpppyyvegvtvfritygetggnspvqeft
    vpywtetatisglkpgvdytitvyaemypgspwagqvmdiqpisinyrtegsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s0tE (E:)
    adlevvaatptslliswpppyyvegvtvfritygetggnspvqeftvpywtetatisglk
    pgvdytitvyaemypgspwmdiqpisinyrt