PDB entry 4s0o

View 4s0o on RCSB PDB site
Description: Crystal Structure of the Autoinhibited Dimer of Pro-apoptotic BAX (I)
Class: apoptosis
Keywords: bcl-2 family protein, apoptosis regulator, autoinhibited dimer, apoptosis
Deposited on 2015-01-02, released 2016-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator BAX
    Species: Homo sapiens [TaxId:9606]
    Gene: BAX, BCL2L4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07812 (Start-191)
      • engineered mutation (167)
    Domains in SCOPe 2.06: d4s0oa_
  • Chain 'B':
    Compound: Apoptosis regulator BAX
    Species: Homo sapiens [TaxId:9606]
    Gene: BAX, BCL2L4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07812 (Start-191)
      • engineered mutation (167)
    Domains in SCOPe 2.06: d4s0ob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4s0oA (A:)
    mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
    eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
    vlkalctkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagv
    ltasltiwkkmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s0oA (A:)
    ptsseqimktgalllqgfiqdraeapelaldpvpqdastkklseclkrigdeldsnmelq
    rmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalctkvpelirtim
    gwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagvltasltiwkkmg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4s0oB (B:)
    mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
    eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
    vlkalctkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagv
    ltasltiwkkmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s0oB (B:)
    ptsseqimktgalllqgfiqdrageapelaldpvpqdastkklseclkrigdeldsnmel
    qrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalctkvpelirti
    mgwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagvltasltiwkkmg