PDB entry 4s0l

View 4s0l on RCSB PDB site
Description: Biphenylalanine modified threonyl-tRNA synthetase from Pyrococcus abyssi: I11BIF, Y79V, and F123V mutant
Class: ligase
Keywords: beta-alpha-beta fold, editing domain, tRNA-synthetase, Ligase, Biphenylalanine, unnatural amino acid, threonine-tRNA ligase
Deposited on 2014-12-31, released 2015-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Threonine--tRNA ligase
    Species: Pyrococcus abyssi GE5 [TaxId:272844]
    Gene: PAB1490, PYRAB13430, thrS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UZ14 (0-End)
      • engineered mutation (7)
      • engineered mutation (10)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (120)
      • engineered mutation (122)
    Domains in SCOPe 2.08: d4s0la_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4s0lA (A:)
    mrvllihadyfeyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvvpwahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    iavkisckghplaelsrtivpeelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s0lA (A:)
    mrvllihadyfeyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvvpwahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    iavkisckghplaelsrtivpe