PDB entry 4rza

View 4rza on RCSB PDB site
Description: Pre-mRNA-splicing factor 38A AS 1-205
Class: RNA binding protein
Keywords: RNA-splicing, RNA BINDING PROTEIN
Deposited on 2014-12-19, released 2015-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-splicing factor 38A
    Species: Homo sapiens [TaxId:9606]
    Gene: PRPF38A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rzaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rzaA (A:)
    manrtvkdahsihgtnpqylvekiirtriyeskywkeecfgltaelvvdkamelrfvggv
    yggnikptpflcltlkmlqiqpekdiivefiknedfkyvrmlgalymrltgtaidcykyl
    eplyndyrkiksqnrngefelmhvdefidellhservcdiilprlqkryvleeaeqlepr
    vsaleedmddvesseeeeeedekle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rzaA (A:)
    manrtvkdahsihgtnpqylvekiirtriyeskywkeecfgltaelvvdkamelrfvggv
    yggnikptpflcltlkmlqiqpekdiivefiknedfkyvrmlgalymrltgtaidcykyl
    eplyndyrkiksqnrngefelmhvdefidellhservcdiilprlqkryvleeaeqlep