PDB entry 4ryx

View 4ryx on RCSB PDB site
Description: Crystal structure of RPE65 in complex with emixustat and palmitate, P6522 crystal form
Class: isomerase
Keywords: 7-bladed beta propeller, monotopic membrane protein, non-heme iron enzyme, retinoid isomerase, ISOMERASE, HYDROLASE
Deposited on 2014-12-17, released 2015-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoid isomerohydrolase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28175 (Start-532)
      • conflict (340)
    Domains in SCOPe 2.07: d4ryxa_
  • Heterogens: FE2, PLM, A3V, SO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ryxA (A:)
    mssqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhl
    fdgqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdpcknifsrff
    syfrgvevtdnalvniypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatah
    phiendgtvynigncfgknfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyv
    hsfgltpnyivfvetpvkinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyi
    nnkyrtspfnlfhhintyedheflivdlccwkgfefvynylylanlrenweevkknarka
    pqpevrryvlplnidkadtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpq
    inyqkyggkpytyayglglnhfvpdrlcklnvktketwvwqepdsypsepifvshpdale
    eddgvvlsvvvspgagqkpayllilnakdlsevaraeveinipvtfhglfkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ryxA (A:)
    qvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfdg
    qallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdfrgvevtdnalvn
    iypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatahphiendgtvynignc
    fgsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyvhsfgltpnyivfvetpvk
    inlfkflsganymdcfesnetmgvwlhiadkkrkkyinnkyrtspfnlfhhintyedhef
    livdlccwkgfefvynylylanlrenweevkknarkapqpevrryvlplnidkadtgknl
    vtlpnttatailcsdetiwlepevlfsgprqafefpqinyqkyggkpytyayglglnhfv
    pdrlcklnvktketwvwqepdsypsepifvshpdaleeddgvvlsvvvspgagqkpayll
    ilnakdlsevaraeveinipvtfhglfkks