PDB entry 4ryv

View 4ryv on RCSB PDB site
Description: Crystal structure of yellow lupin LLPR-10.1A protein in complex with trans-zeatin
Class: plant protein
Keywords: pr-10 fold, ligand binding, phytohormone binding protein, trans-zeatin, cytokinin, plant protein
Deposited on 2014-12-17, released 2015-12-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein LLPR-10.1A
    Species: Lupinus luteus [TaxId:3873]
    Gene: LLR18A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ryva_
  • Heterogens: ZEA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ryvA (A:)
gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaihd
ghtsfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfh
tkgdvlsetvrdqakfkglglfkaiegyvlahpdy