PDB entry 4ryu

View 4ryu on RCSB PDB site
Description: Crystal Structure of C2 form of E112A Mutant of Stationary Phase Survival Protein (SurE) from Salmonella typhimurium
Class: hydrolase
Keywords: Stationary phase survival protein, Domain swapping, Rossmann fold like, Phosphatase, HYDROLASE
Deposited on 2014-12-17, released 2015-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella enterica subsp. enterica serovar Enteritidis [TaxId:1412588]
    Gene: AV66_15865, surE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (9-13)
      • engineered mutation (125)
    Domains in SCOPe 2.06: d4ryua1, d4ryua2
  • Chain 'B':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella enterica subsp. enterica serovar Enteritidis [TaxId:1412588]
    Gene: AV66_15865, surE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (12-13)
      • engineered mutation (125)
    Domains in SCOPe 2.06: d4ryub1, d4ryub2
  • Chain 'C':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella enterica subsp. enterica serovar Enteritidis [TaxId:1412588]
    Gene: AV66_15865, surE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (13)
      • engineered mutation (125)
    Domains in SCOPe 2.06: d4ryuc1, d4ryuc2
  • Chain 'D':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella enterica subsp. enterica serovar Enteritidis [TaxId:1412588]
    Gene: AV66_15865, surE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (13)
      • engineered mutation (125)
    Domains in SCOPe 2.06: d4ryud1, d4ryud2
  • Heterogens: PO4, MG, GOL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ryuA (A:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltahsahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ryuA (A:)
    hgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtft
    fdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrh
    lgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtr
    cgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahs
    ahdvvsdwldsvgvgtqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ryuB (B:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltahsahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ryuB (B:)
    asmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdn
    gdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgf
    palavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgs
    rhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahd
    vvsdwldsvgvgtqw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ryuC (C:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltahsahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ryuC (C:)
    smrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdng
    diavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgfp
    alavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsr
    hpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdv
    vsdwldsvgvgtqw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ryuD (D:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltahsahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ryuD (D:)
    smrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdng
    diavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgfp
    alavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsr
    hpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdv
    vsdwldsvgvgtqw