SCOPe 2.08: Structural Classification of Proteins

PDB entry 4rxf

View 4rxf on RCSB PDB site
Description: Fructose-6-phosphate aldolase Y131F from E.coli
Class: lyase
Keywords: Tim barrel, homodecamer, Lyase, FSAA TalB
Deposited on 2014-12-11, released 2015-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
  - engineered mutation (136)
Domains in SCOPe 2.08: d4rxfa1, d4rxfa2
Chain 'B':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
  - engineered mutation (136)
Domains in SCOPe 2.08: d4rxfb1, d4rxfb2
Chain 'C':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
  - engineered mutation (136)
Domains in SCOPe 2.08: d4rxfc1, d4rxfc2
Chain 'D':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
  - engineered mutation (136)
Domains in SCOPe 2.08: d4rxfd1, d4rxfd2
Chain 'E':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
  - engineered mutation (136)
Domains in SCOPe 2.08: d4rxfe1, d4rxfe2
Chain 'F':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
  - engineered mutation (136)
Domains in SCOPe 2.08: d4rxff1, d4rxff2
Chain 'G':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
  - engineered mutation (136)
Domains in SCOPe 2.08: d4rxfg1, d4rxfg2
Chain 'H':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
  - engineered mutation (136)
Domains in SCOPe 2.08: d4rxfh1, d4rxfh2
Chain 'I':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
  - engineered mutation (136)
Domains in SCOPe 2.08: d4rxfi1, d4rxfi2
Chain 'J':
Compound: Fructose-6-phosphate aldolase 1
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b0825, fsa, fsaA, JW5109, mipB, ybiZ
Database cross-references and differences (RAF-indexed):
- Uniprot P78055 (7-225)
  - expression tag (6)
  - engineered mutation (136)
Domains in SCOPe 2.08: d4rxfj1, d4rxfj2
Heterogens: PO4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4rxfA (A:)
mhhhhhhelyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqg
rlfaqvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavyga
aqgllsalagaeyvapfvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqal
dcllagcesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi