PDB entry 4rx3

View 4rx3 on RCSB PDB site
Description: A triple mutant in the omega-loop of TEM-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for catalysis
Class: hydrolase
Keywords: globular, beta-lactamase, hydrolase
Deposited on 2014-12-08, released 2015-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-lactamase TEM
  Species: Escherichia coli [TaxId:562]
  Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62593 (0-262)
    • engineered mutation (44)
    • engineered mutation (139-141)
  Domains in SCOPe 2.07: d4rx3a_
• Heterogens: FLC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4rx3A (A:)
  hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmgtfkvllcgavlsrvd
  agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
  keltaflhnmgdhvtrldryygelneaipnderdttmpaamattlrklltgelltlasrq
  qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
  sqatmdernrqiaeigaslikhw