PDB entry 4rvj

View 4rvj on RCSB PDB site
Description: Crystal structure of multidrug-resistant clinical isolate A02 HIV-1 protease in complex with amprenavir
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 PROTEASE-INHIBITOR COMPLEX, amprenavir, NON-PEPTIDIC PROTEASE INHIBITOR, Hydrolase, hydrolase-hydrolase inhibitor complex
Deposited on 2014-11-26, released 2016-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9J006 (0-98)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d4rvja_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9J006 (0-98)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d4rvjb_
  • Chain 'C':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9J006 (0-98)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d4rvjc_
  • Chain 'D':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9J006 (0-98)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d4rvjd_
  • Heterogens: 478, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rvjA (A:)
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrwkprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rvjB (B:)
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrwkprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgctlnf

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rvjC (C:)
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrwkprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgctlnf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rvjD (D:)
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrwkprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgctlnf