PDB entry 4rvi

View 4rvi on RCSB PDB site
Description: Crystal structure of multidrug-resistant clinical isolate A02 HIV-1 protease in complex with non-peptidic inhibitor, GRL0519
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 PROTEASE-INHIBITOR COMPLEX, GRL0519, G52, PROTEASE INHIBITOR, NON-PEPTIDIC PROTEASE INHIBITOR, Hydrolase, hydrolase-hydrolase inhibitor complex
Deposited on 2014-11-26, released 2016-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9J006 (0-98)
      • engineered mutation (41)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d4rvia_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9J006 (0-98)
      • engineered mutation (41)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d4rvib_
  • Chain 'C':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9J006 (0-98)
      • engineered mutation (41)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d4rvic_
  • Chain 'D':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9J006 (0-98)
      • engineered mutation (41)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d4rvid_
  • Heterogens: G52, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rviA (A:)
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrykprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rviB (B:)
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrykprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgctlnf

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rviC (C:)
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrykprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgctlnf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rviD (D:)
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrykprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgctlnf