PDB entry 4rv6

View 4rv6 on RCSB PDB site
Description: Human ARTD1 (PARP1) catalytic domain in complex with inhibitor Rucaparib
Class: Transferase/Transferase inhibitor
Keywords: ADP-ribosyl Transferase, ADP-ribosylation, Transferase-Transferase inhibitor complex
Deposited on 2014-11-25, released 2015-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ADPRT, PARP1, PPOL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (2-End)
      • variant (102)
    Domains in SCOPe 2.06: d4rv6a1, d4rv6a2
  • Chain 'B':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ADPRT, PARP1, PPOL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (2-End)
      • variant (102)
    Domains in SCOPe 2.06: d4rv6b1, d4rv6b2
  • Chain 'C':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ADPRT, PARP1, PPOL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (2-End)
      • variant (102)
    Domains in SCOPe 2.06: d4rv6c1, d4rv6c2
  • Chain 'D':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ADPRT, PARP1, PPOL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (2-End)
      • variant (102)
    Domains in SCOPe 2.06: d4rv6d1, d4rv6d2
  • Heterogens: SO4, RPB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rv6A (A:)
    smksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
    vsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllr
    ggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifki
    eregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfad
    mvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdps
    anisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rv6A (A:)
    ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
    qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
    sdskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkiereg
    ecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsk
    sanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanis
    ldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rv6B (B:)
    smksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
    vsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllr
    ggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifki
    eregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfad
    mvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdps
    anisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rv6B (B:)
    ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
    qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
    sddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkier
    egecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmv
    sksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsan
    isldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rv6C (C:)
    smksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
    vsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllr
    ggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifki
    eregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfad
    mvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdps
    anisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rv6C (C:)
    ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
    qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
    ssskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkiereg
    ecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsk
    sanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanis
    ldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4rv6D (D:)
    smksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
    vsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllr
    ggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifki
    eregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfad
    mvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdps
    anisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rv6D (D:)
    ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
    qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
    sddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkier
    egecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmv
    sksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsan
    isldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfk