PDB entry 4ruv

View 4ruv on RCSB PDB site
Description: Crystal structure of thioredoxin 2 from Staphylococcus aureus NCTC8325
Class: oxidoreductase
Keywords: oxidoreductase, electron transport
Deposited on 2014-11-22, released 2015-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Staphylococcus aureus subsp. aureus NCTC 8325 [TaxId:93061]
    Gene: SAOUHSC_00834
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ruva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4ruvA (A:)
hhhhhhgsmqsiksnesfksvinsdtpvivkfeagwcpdcramdlwidpiveqyndyqwy
tvnrdeledvvvenevmgipsllvfkngdkiahlhsanakspeqvesflaetfk

    Sequence, based on observed residues (ATOM records): (download) 
    >4ruvA (A:)
mqsiksnesfksvinsdtpvivkfeagwcpdcramdlwidpiveqyndyqwytvnrdele
dvvvenevmgipsllvfkngdkiahlhsanakspeqvesflaetfk