PDB entry 4rtx

View 4rtx on RCSB PDB site
Description: Crystal structure of the Src tyrosine kinase SH3 domain T96G/Q128R mutant
Class: protein binding
Keywords: beta shandwich, SH3 domain, PROTEIN BINDING
Deposited on 2014-11-16, released 2015-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (4-60)
      • expression tag (0-3)
      • engineered mutation (15)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d4rtxa1, d4rtxa2
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (4-60)
      • expression tag (0-3)
      • engineered mutation (15)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d4rtxb1, d4rtxb2
  • Chain 'C':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (4-60)
      • expression tag (0-3)
      • engineered mutation (15)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d4rtxc1, d4rtxc2
  • Chain 'D':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (4-60)
      • expression tag (0-3)
      • engineered mutation (15)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d4rtxd1, d4rtxd2
  • Heterogens: NI, SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rtxA (A:)
    gshmtfvalydyesrgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
    d
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rtxB (B:)
    gshmtfvalydyesrgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
    d
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rtxC (C:)
    gshmtfvalydyesrgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
    d
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rtxD (D:)
    gshmtfvalydyesrgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
    d