PDB entry 4rtu

View 4rtu on RCSB PDB site
Description: Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain T96G/Q128R mutant
Class: protein binding, signaling protein
Keywords: beta shandwich, SH3 domain, PROTEIN BINDING, SIGNALING PROTEIN
Deposited on 2014-11-16, released 2015-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (4-End)
      • expression tag (3)
      • engineered mutation (15)
      • engineered mutation (47)
    Domains in SCOPe 2.05: d4rtua_
  • Heterogens: PGE, PEG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rtuA (A:)
    gshmtfvalydyesrgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rtuA (A:)
    mtfvalydyesrgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps