PDB entry 4rt6

View 4rt6 on RCSB PDB site
Description: Structure of a complex between hemopexin and hemopexin binding protein
Class: protein binding
Keywords: beta-helix; beta-propeller domain, interaction of HxuA with hemopexin enables heme release from hemopexin, outer membrane, Protein Binding
Deposited on 2014-11-13, released 2016-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme/hemopexin-binding protein
    Species: Haemophilus influenzae Rd KW20 [TaxId:71421]
    Gene: hxuA, HI_0264
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: hemopexin
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4rt6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4rt6B (B:)
vpltsahgnvtegesgtkpeadvieqcsdgwsfdattlddngtmlffkdefvwkshrgir
eliserwknfigpvdaafrhghtsvylikgdkvwvytseknekvypkslqdefpgipfpl
daavechrgecqdegilffqgnrkwfwdlttgtkkerswpavgnctsalrwlgryycfqg
nqflrfnpvsgevppgypldvrdyflscpgrghr

    Sequence, based on observed residues (ATOM records): (download) 
    >4rt6B (B:)
ieqcsdgwsfdattlddngtmlffkdefvwkshriserwknfigpvdaafrhtsvylikg
dkvwvytsypkslqdefpgipfpldaavechrgecqdegilffqgnrkwfwdlttgtkke
rswpavgnctsalrwlgryycfqgnqflrfnpvsgevppgypldvrdyflsc