PDB entry 4rss

View 4rss on RCSB PDB site
Description: Crystal structure of tyrosine-protein kinase SYK with an inhibitor
Class: transferase/transferase inhibitor
Keywords: Kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-11-11, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rssa_
  • Heterogens: 4MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rssA (A:)
    eeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkd
    ellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielv
    hqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwp
    vkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpa
    gcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rssA (A:)
    yldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneapalkdellaeanvmq
    qldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyl
    eesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecin
    yykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlm
    nlcwtydvenrpgfaavelrlrnyyydvv