PDB entry 4rsk

View 4rsk on RCSB PDB site
Description: structure of the k7a/r10a/k66a variant of ribonuclease a complexed with 3'-ump
Deposited on 1998-04-09, released 1998-12-09
The last revision prior to the SCOP 1.71 freeze date was dated 1999-08-22, with a file datestamp of 1999-08-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.168
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d4rsk__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4rsk_ (-)
  ketaaaafeaqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvacangqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv