PDB entry 4rsh

View 4rsh on RCSB PDB site
Description: Structure of a putative lipolytic protein of G-D-S-L family from Desulfitobacterium hafniense DCB-2
Class: structural genomics, unknown function
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2014-11-07, released 2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipolytic protein G-D-S-L family
    Species: Desulfitobacterium hafniense DCB-2 [TaxId:272564]
    Gene: ACL22416, Dhaf_4411
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rsha_
  • Chain 'B':
    Compound: Lipolytic protein G-D-S-L family
    Species: Desulfitobacterium hafniense DCB-2 [TaxId:272564]
    Gene: ACL22416, Dhaf_4411
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rshb_
  • Chain 'C':
    Compound: Lipolytic protein G-D-S-L family
    Species: Desulfitobacterium hafniense DCB-2 [TaxId:272564]
    Gene: ACL22416, Dhaf_4411
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rshc_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rshA (A:)
    snantkvvaigdsftfgypgntenswpavlgqtsqievvnkglksqtaqdlysrfdadvl
    aekpgrviifvgngdaikevpletfqqhikamvekaesnhiipilalplpytgvqntike
    frewessyakeknilvldfatvlmdadnvylegllskeanypskegyklmgeyasrvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rshA (A:)
    ntkvvaigdsftfgypgntenswpavlgqtsqievvnkglksqtaqdlysrfdadvlaek
    pgrviifvgngdaikevpletfqqhikamvekaesnhiipilalplpytgvqntikefre
    wessyakeknilvldfatvlmdadnvylegllskeanypskegyklmgeyasrvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rshB (B:)
    snantkvvaigdsftfgypgntenswpavlgqtsqievvnkglksqtaqdlysrfdadvl
    aekpgrviifvgngdaikevpletfqqhikamvekaesnhiipilalplpytgvqntike
    frewessyakeknilvldfatvlmdadnvylegllskeanypskegyklmgeyasrvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rshB (B:)
    ntkvvaigdsftfgypgntenswpavlgqtsqievvnkglksqtaqdlysrfdadvlaek
    pgrviifvgngdaikevpletfqqhikamvekaesnhiipilalplpytgvqntikefre
    wessyakeknilvldfatvlmdadnvylegllskeanypskegyklmgeyasrvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rshC (C:)
    snantkvvaigdsftfgypgntenswpavlgqtsqievvnkglksqtaqdlysrfdadvl
    aekpgrviifvgngdaikevpletfqqhikamvekaesnhiipilalplpytgvqntike
    frewessyakeknilvldfatvlmdadnvylegllskeanypskegyklmgeyasrvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rshC (C:)
    ntkvvaigdsftfgypgntenswpavlgqtsqievvnkglksqtaqdlysrfdadvlaek
    pgrviifvgngdaikevpletfqqhikamvekaesnhiipilalplpytgvqntikefre
    wessyakeknilvldfatvlmdadnvylegllskeanypskegyklmgeyasrvl