PDB entry 4rrr

View 4rrr on RCSB PDB site
Description: K121M mutant of N-terminal editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi with L-Thr3AA
Class: ligase
Keywords: DTD-like fold, Proofreading, LIGASE
Deposited on 2014-11-06, released 2015-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Threonine--tRNA ligase
    Species: Pyrococcus abyssi GE5 [TaxId:272844]
    Gene: thrS, PYRAB13430, PAB1490
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UZ14 (0-End)
      • engineered mutation (120)
    Domains in SCOPe 2.06: d4rrra_
  • Chain 'B':
    Compound: Threonine--tRNA ligase
    Species: Pyrococcus abyssi GE5 [TaxId:272844]
    Gene: thrS, PYRAB13430, PAB1490
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UZ14 (0-End)
      • engineered mutation (120)
    Domains in SCOPe 2.06: d4rrrb_
  • Heterogens: A3T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rrrA (A:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    mafkisckghplaelsrtivpeearve
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rrrA (A:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    mafkisckghplaelsrtivpee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rrrB (B:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    mafkisckghplaelsrtivpeearve
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rrrB (B:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    mafkisckghplaelsrtivpe