PDB entry 4rrj

View 4rrj on RCSB PDB site
Description: Y115A mutant of N-terminal editing domain of threonyl-tRNA synthetase from Aeropyrum pernix with L-Ser3AA
Class: ligase
Keywords: DTD-like fold, Proofreading, LIGASE
Deposited on 2014-11-06, released 2015-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable threonine--tRNA ligase 2
    Species: Aeropyrum pernix K1 [TaxId:272557]
    Gene: thrS2, APE_0117.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YFY3 (0-135)
      • engineered mutation (114)
    Domains in SCOPe 2.08: d4rrja_
  • Heterogens: A3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rrjA (A:)
mrllylhadrfeyktvkpalknppdppgeasfgealvvfttvedgdgpqtvmyaasdias
hssrlkvttvilypyahlssrlakpmaahkrlielegalrtkfpghvhrapfgwaksfsi
ackghplaelsrsfte