PDB entry 4rqp

View 4rqp on RCSB PDB site
Description: Crystal structure of the natually occurring empty particle of a clinical C4 strain EV71
Class: Virus
Keywords: beta barrel, icosahedral virus, natually occurring empty particle with unknown function, replicate in host cell cytoplasm, Virus
Deposited on 2014-11-04, released 2014-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: capsid protein vp3
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F6KTB0 (0-End)
      • engineered mutation (226)
    Domains in SCOPe 2.07: d4rqpb_
  • Chain 'C':
    Compound: capsid protein VP0
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rqpc_
  • Chain 'E':
    Compound: Capsid protein VP1
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: capsid protein vp3
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F6KTB0 (0-End)
      • engineered mutation (226)
    Domains in SCOPe 2.07: d4rqpf_
  • Chain 'G':
    Compound: capsid protein VP0
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rqpg_
  • Chain 'I':
    Compound: Capsid protein VP1
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: capsid protein vp3
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F6KTB0 (0-End)
      • engineered mutation (226)
    Domains in SCOPe 2.07: d4rqpj_
  • Chain 'K':
    Compound: capsid protein VP0
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rqpk_
  • Chain 'M':
    Compound: Capsid protein VP1
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: capsid protein vp3
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F6KTB0 (0-End)
      • engineered mutation (226)
    Domains in SCOPe 2.07: d4rqpn_
  • Chain 'O':
    Compound: capsid protein VP0
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rqpo_
  • Chain 'Q':
    Compound: Capsid protein VP1
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: capsid protein vp3
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F6KTB0 (0-End)
      • engineered mutation (226)
    Domains in SCOPe 2.07: d4rqpr_
  • Chain 'S':
    Compound: capsid protein VP0
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rqpB (B:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
    ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqtgt
    iq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rqpB (B:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisntyttgl
    vsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rqpC (C:)
    mgsqvstqrsgshensnsategstinyttinyykdsyaatagkqslkqdpdkfanpvkdi
    ftemaaplkspsaeacgysdrvaqltignstittqeaaniivgygewpsycsdsdatavd
    kptrpdvsvnrfytldtklweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvq
    cnaskfhqgallvavlpeyvigtvaggtgtedshppykqtqpgadgfelqhpyvldagip
    isqltvcphqwinlrtnncatiivpyinalpfdsalnhcnfgllvvpispldydqgatpv
    ipititlapmcsefaglrqavtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rqpC (C:)
    vaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtklwe
    ksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpeyvi
    gtvaggtgtedshppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnncat
    iivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglrq
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4rqpF (F:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
    ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqtgt
    iq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rqpF (F:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisntyttgl
    vsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4rqpG (G:)
    mgsqvstqrsgshensnsategstinyttinyykdsyaatagkqslkqdpdkfanpvkdi
    ftemaaplkspsaeacgysdrvaqltignstittqeaaniivgygewpsycsdsdatavd
    kptrpdvsvnrfytldtklweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvq
    cnaskfhqgallvavlpeyvigtvaggtgtedshppykqtqpgadgfelqhpyvldagip
    isqltvcphqwinlrtnncatiivpyinalpfdsalnhcnfgllvvpispldydqgatpv
    ipititlapmcsefaglrqavtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rqpG (G:)
    vaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtklwe
    ksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpeyvi
    gtvaggtgtedshppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnncat
    iivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglrq
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4rqpJ (J:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
    ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqtgt
    iq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rqpJ (J:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisntyttgl
    vsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4rqpK (K:)
    mgsqvstqrsgshensnsategstinyttinyykdsyaatagkqslkqdpdkfanpvkdi
    ftemaaplkspsaeacgysdrvaqltignstittqeaaniivgygewpsycsdsdatavd
    kptrpdvsvnrfytldtklweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvq
    cnaskfhqgallvavlpeyvigtvaggtgtedshppykqtqpgadgfelqhpyvldagip
    isqltvcphqwinlrtnncatiivpyinalpfdsalnhcnfgllvvpispldydqgatpv
    ipititlapmcsefaglrqavtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rqpK (K:)
    vaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtklwe
    ksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpeyvi
    gtvaggtgtedshppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnncat
    iivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglrq
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4rqpN (N:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
    ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqtgt
    iq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rqpN (N:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisntyttgl
    vsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqt
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4rqpO (O:)
    mgsqvstqrsgshensnsategstinyttinyykdsyaatagkqslkqdpdkfanpvkdi
    ftemaaplkspsaeacgysdrvaqltignstittqeaaniivgygewpsycsdsdatavd
    kptrpdvsvnrfytldtklweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvq
    cnaskfhqgallvavlpeyvigtvaggtgtedshppykqtqpgadgfelqhpyvldagip
    isqltvcphqwinlrtnncatiivpyinalpfdsalnhcnfgllvvpispldydqgatpv
    ipititlapmcsefaglrqavtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rqpO (O:)
    vaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtklwe
    ksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpeyvi
    gtvaggtgtedshppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnncat
    iivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglrq
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4rqpR (R:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
    ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqtgt
    iq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rqpR (R:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisntyttgl
    vsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqt
    

  • Chain 'S':
    No sequence available.