PDB entry 4rnt

View 4rnt on RCSB PDB site
Description: his 92 ala mutation in ribonuclease t1 induces segmental flexibility. an x-ray study
Deposited on 1990-02-13, released 1992-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1992-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.162
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d4rnt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rnt_ (-)
    acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
    ilssgdvysggspgadrvvfnennqlagvitatgasgnnfvect