PDB entry 4rnd

View 4rnd on RCSB PDB site
Description: Crystal Structure of the subunit DF-assembly of the eukaryotic V-ATPase.
Class: Hydrolase
Keywords: alpha helical, Rossmann Fold, Hydrolase, Regulatory, Coupling
Deposited on 2014-10-24, released 2014-12-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 3.18 Å
R-factor: 0.204
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: V-type proton ATPase subunit D
  Species: Saccharomyces cerevisiae S288c [TaxId:559292]
  Gene: SYGP-ORF11, VMA8, YEL051W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32610
• Chain 'B':
  Compound: V-type proton ATPase subunit F
  Species: Saccharomyces cerevisiae S288c [TaxId:559292]
  Gene: VMA7, YGR020C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39111 (0-117)
  Domains in SCOPe 2.08: d4rndb_
• Chain 'C':
  Compound: V-type proton ATPase subunit D
  Species: Saccharomyces cerevisiae S288c [TaxId:559292]
  Gene: SYGP-ORF11, VMA8, YEL051W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32610
• Chain 'D':
  Compound: V-type proton ATPase subunit F
  Species: Saccharomyces cerevisiae S288c [TaxId:559292]
  Gene: VMA7, YGR020C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39111
  Domains in SCOPe 2.08: d4rndd_
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4rndB (B:)
  maekrtliaviadedtttglllagigqitpetqeknffvyqegkttkeeitdkfnhftee
  rddiaillinqhiaenirarvdsftnafpaileipskdhpydpekdsvlkrvrklfge
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >4rndD (D:)
  maekrtliaviadedtttglllagigqitpetqeknffvyqegkttkeeitdkfnhftee
  rddiaillinqhiaenirarvdsftnafpaileipskdhpydpekdsvlkrvrklfge
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4rndD (D:)
  aekrtliaviadedtttglllagigqitpetqeknffvyqegkttkeeitdkfnhfteer
  ddiaillinqhiaenirarvdsftnafpaileipskdhpydpekdsvlkrvrklf