PDB entry 4rnc

View 4rnc on RCSB PDB site
Description: Crystal structure of an esterase RhEst1 from Rhodococcus sp. ECU1013
Class: hydrolase
Keywords: alpha/beta hydrolase fold, HYDROLASE
Deposited on 2014-10-23, released 2015-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: Rhodococcus sp. ECU1013 [TaxId:1213589]
    Database cross-references and differences (RAF-indexed):
    • PDB 4RNC
    Domains in SCOPe 2.07: d4rnca1, d4rnca2
  • Chain 'B':
    Compound: esterase
    Species: Rhodococcus sp. ECU1013 [TaxId:1213589]
    Database cross-references and differences (RAF-indexed):
    • PDB 4RNC
    Domains in SCOPe 2.07: d4rncb_
  • Chain 'C':
    Compound: esterase
    Species: Rhodococcus sp. ECU1013 [TaxId:1213589]
    Database cross-references and differences (RAF-indexed):
    • PDB 4RNC
    Domains in SCOPe 2.07: d4rncc_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rncA (A:)
    mgsshhhhhhssglvprgshmmsireavsvdgtsivyrvtgnsagtplvllhgwaqssqc
    wgeqvladlaadyrliavdlrghgysdapesgyddsanwagdvaavlaaegvtenaillg
    wsygglvicdylaahgtgavagavlvgaitsigrgekggkvgsamrsavpgamsedprea
    iralgafgnaltgppegkgaasqalfgyslstrprvraalfnravghdellrnldipvlv
    lhgtddsvvdvsagkhaeelipksqasywvgcnhgpfvedptrfvsevrtfisslgklag
    aalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rncA (A:)
    msireavsvdgtsivyrvtgnsagtplvllhgwaqssqcwgeqvladlaadyrliavdlr
    ghgysdapesgyddsanwagdvaavlaaegvtenaillgwsygglvicdylaahgtgava
    gavlvgaitsigrgekggkvgsamrsavpgamsedpreairalgafgnaltgppegkgaa
    sqalfgyslstrprvraalfnravghdellrnldipvlvlhgtddsvvdvsagkhaeeli
    pksqasywvgcnhgpfvedptrfvsevrtfisslgklagaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rncB (B:)
    mgsshhhhhhssglvprgshmmsireavsvdgtsivyrvtgnsagtplvllhgwaqssqc
    wgeqvladlaadyrliavdlrghgysdapesgyddsanwagdvaavlaaegvtenaillg
    wsygglvicdylaahgtgavagavlvgaitsigrgekggkvgsamrsavpgamsedprea
    iralgafgnaltgppegkgaasqalfgyslstrprvraalfnravghdellrnldipvlv
    lhgtddsvvdvsagkhaeelipksqasywvgcnhgpfvedptrfvsevrtfisslgklag
    aalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rncB (B:)
    msireavsvdgtsivyrvtgnsagtplvllhgwaqssqcwgeqvladlaadyrliavdlr
    ghgysdapesgyddsanwagdvaavlaaegvtenaillgwsygglvicdylaahgtgava
    gavlvgaitsigrgekggkvgsamrsavpgamsedpreairalgafgnaltgppegkgaa
    sqalfgyslstrprvraalfnravghdellrnldipvlvlhgtddsvvdvsagkhaeeli
    pksqasywvgcnhgpfvedptrfvsevrtfisslg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rncC (C:)
    mgsshhhhhhssglvprgshmmsireavsvdgtsivyrvtgnsagtplvllhgwaqssqc
    wgeqvladlaadyrliavdlrghgysdapesgyddsanwagdvaavlaaegvtenaillg
    wsygglvicdylaahgtgavagavlvgaitsigrgekggkvgsamrsavpgamsedprea
    iralgafgnaltgppegkgaasqalfgyslstrprvraalfnravghdellrnldipvlv
    lhgtddsvvdvsagkhaeelipksqasywvgcnhgpfvedptrfvsevrtfisslgklag
    aalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rncC (C:)
    msireavsvdgtsivyrvtgnsagtplvllhgwaqssqcwgeqvladlaadyrliavdlr
    ghgysdapesgyddsanwagdvaavlaaegvtenaillgwsygglvicdylaahgtgava
    gavlvgaitsigrgekggkvgsamrsavpgamsedpreairalgafgnaltgppegkgaa
    sqalfgyslstrprvraalfnravghdellrnldipvlvlhgtddsvvdvsagkhaeeli
    pksqasywvgcnhgpfvedptrfvsevrtfisslg