PDB entry 4rmw

View 4rmw on RCSB PDB site
Description: Crystal structure of the D76A Beta-2 Microglobulin mutant
Class: immune system
Keywords: immunoglobin, beta-sandwitch, amyloidosis, pathologic mutation, genetic disease, MHC class I, IMMUNE SYSTEM
Deposited on 2014-10-22, released 2015-11-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P, NM_004048
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • initiating methionine (0)
      • engineered mutation (76)
    Domains in SCOPe 2.05: d4rmwa_
  • Heterogens: PGE, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rmwA (A:)
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekaeyacrvnhvtlsqpkivkwdrdm