PDB entry 4rmh

View 4rmh on RCSB PDB site
Description: Human Sirt2 in complex with SirReal2 and Ac-Lys-H3 peptide
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Hydrolase-Hydrolase Inhibitor complex
Deposited on 2014-10-21, released 2015-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.181
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-dependent protein deacetylase sirtuin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT2, SIR2L, SIR2L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rmha_
  • Chain 'B':
    Compound: Ac-Lys-H3 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4RMH
  • Heterogens: ZN, 3TE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rmhA (A:)
    ghmerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhl
    pypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtl
    eriagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdi
    vffgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagq
    sdpflgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasi
    daqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rmhA (A:)
    erlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnkyhlpypea
    ifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleriag
    leqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivffge
    slparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdpfl
    ggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaqs
    

  • Chain 'B':
    No sequence available.