PDB entry 4rm4

View 4rm4 on RCSB PDB site
Description: The crystal structure of the versatile cytochrome P450 enzyme CYP109B1 from Bacillus subtilis
Class: electron transport
Keywords: Cytochrome P450, Secondary metabolites biosynthesis, transport, catabolism, ELECTRON TRANSPORT
Deposited on 2014-10-18, released 2015-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Bacillus subtilis subsp. subtilis [TaxId:135461]
    Gene: BSU12210, genomic DNA, yjiB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rm4a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rm4A (A:)
    mnvlnrrqalqrallngknkqdayhpfpwyesmrkdapvsfdeenqvwsvflyddvkkvv
    gdkelfsscmpqqtssignsiinmdppkhtkirsvvnkaftprvmkqwepriqeitdeli
    qkfqgrsefdlvhdfsyplpvivisellgvpsahmeqfkawsdllvstpkdkseeaekaf
    leerdkceeelaaffagiieekrnkpeqdiisilveaeetgeklsgeelipfctlllvag
    netttnlisnamysiletpgvyeelrshpelmpqaveealrfrapapvlrriakrdteig
    ghlikegdmvlafvasanrdeakfdrphmfdirrhpnphiafghgihfclgaplarlean
    ialtslisafphmecvsitpiensviyglksfrvkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rm4A (A:)
    dayhpfpwyesmrkdapvsfdeenqvwsvflyddvkkvvgdkelfsscmgnsiinmdppk
    htkirsvvnkaftprvmkqwepriqeitdeliqkfqgrsefdlvhdfsyplpvivisell
    gvpsahmeqfkawsdllvstpkdkseeaekafleerdkceeelaaffagiieekrnkpeq
    diisilvegeklsgeelipfctlllvagnetttnlisnamysiletpgvyeelrshpelm
    pqaveealrfrapapvlrriakrdteigghlikegdmvlafvasanrdeakfdrphmfdi
    rrhpnphiafghgihfclgaplarleanialtslisafphmecvsitpiensviyglksf
    rvkm