PDB entry 4rlh

View 4rlh on RCSB PDB site
Description: Crystal structure of enoyl ACP reductase from Burkholderia pseudomallei in complex with AFN-1252
Class: oxidoreductase
Keywords: Rossmann Fold, enoyl ACP reductase, FabI, AFN-1252, OXIDOREDUCTASE
Deposited on 2014-10-17, released 2015-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: fabI, BPSL2204
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rlha_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: fabI, BPSL2204
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rlhb_
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: fabI, BPSL2204
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rlhc_
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: fabI, BPSL2204
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rlhd_
  • Heterogens: 0WE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rlhA (A:)
    hmahhhhhhmgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritef
    aaefgselvfpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltre
    nfriahdisaysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvr
    ylavslgakgvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagaf
    llsdlasgvtaevmhvdsgfnavvggmaglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rlhA (A:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpisgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvtaevm
    hvdsgfnavvggm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rlhB (B:)
    hmahhhhhhmgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritef
    aaefgselvfpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltre
    nfriahdisaysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvr
    ylavslgakgvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagaf
    llsdlasgvtaevmhvdsgfnavvggmaglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rlhB (B:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rlhC (C:)
    hmahhhhhhmgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritef
    aaefgselvfpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltre
    nfriahdisaysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvr
    ylavslgakgvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagaf
    llsdlasgvtaevmhvdsgfnavvggmaglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rlhC (C:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4rlhD (D:)
    hmahhhhhhmgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritef
    aaefgselvfpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltre
    nfriahdisaysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvr
    ylavslgakgvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagaf
    llsdlasgvtaevmhvdsgfnavvggmaglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rlhD (D:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpisgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvtaevm
    hvdsgfnavvggm