PDB entry 4rkq

View 4rkq on RCSB PDB site
Description: Crystal structure of LacI family transcriptional regulator from Arthrobacter sp. FB24, target EFI-560007
Class: transcription regulator
Keywords: sugar binding, transcription regulation, Enzyme Function Initiative, EFI, structural genomics, transcriptional factor, TRANSCRIPTION REGULATOR
Deposited on 2014-10-13, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.156
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, LacI family
    Species: Arthrobacter sp. [TaxId:290399]
    Gene: Arth_3918
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0K1X3 (Start-285)
      • expression tag (286-287)
    Domains in SCOPe 2.07: d4rkqa1, d4rkqa2
  • Chain 'B':
    Compound: Transcriptional regulator, LacI family
    Species: Arthrobacter sp. [TaxId:290399]
    Gene: Arth_3918
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0K1X3 (Start-285)
      • expression tag (286-287)
    Domains in SCOPe 2.07: d4rkqb1, d4rkqb2
  • Chain 'C':
    Compound: Transcriptional regulator, LacI family
    Species: Arthrobacter sp. [TaxId:290399]
    Gene: Arth_3918
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0K1X3 (Start-285)
      • expression tag (286)
    Domains in SCOPe 2.07: d4rkqc1, d4rkqc2
  • Chain 'D':
    Compound: Transcriptional regulator, LacI family
    Species: Arthrobacter sp. [TaxId:290399]
    Gene: Arth_3918
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0K1X3 (Start-285)
      • expression tag (286)
    Domains in SCOPe 2.07: d4rkqd1, d4rkqd2
  • Heterogens: CL, EDO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rkqA (A:)
    mslsrfakglvqgartsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsg
    ldavehlapqvdavigylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvav
    aqlmdskrqhiayleagsasesdepvpctvrgkavagrldelgaswslivaeetaeaare
    aaaaflrehpetdgilafndlmaagvlkalsgsgrrvpedcavigmdgiplgellspqls
    tmaldlrevgraavellvgllsgavtpgsqssrttlkhrlvlresteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rkqA (A:)
    akglvqgartsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsgldaveh
    lapqvdavigylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvavaqlmds
    krqhiayleagsasesdepvpctvrgkavagrldelgaswslivaeetaeaareaaaafl
    rehpetdgilafndlmaagvlkalsgsgrrvpedcavigmdgiplgellspqlstmaldl
    revgraavellvgllsgavtpgsqssrttlkhrlvlresteg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rkqB (B:)
    mslsrfakglvqgartsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsg
    ldavehlapqvdavigylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvav
    aqlmdskrqhiayleagsasesdepvpctvrgkavagrldelgaswslivaeetaeaare
    aaaaflrehpetdgilafndlmaagvlkalsgsgrrvpedcavigmdgiplgellspqls
    tmaldlrevgraavellvgllsgavtpgsqssrttlkhrlvlresteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rkqB (B:)
    artsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsgldavehlapqvda
    vigylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvavaqlmdskrqhiay
    leagspvpctvrgkavagrldelgaswslivaeetaeaareaaaaflrehpetdgilafn
    dlmaagvlkalsgsgrrvpedcavigmdgiplgellspqlstmaldlrevgraavellvg
    llsgavtpgsqssrttlkhrlvlresteg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rkqC (C:)
    mslsrfakglvqgartsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsg
    ldavehlapqvdavigylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvav
    aqlmdskrqhiayleagsasesdepvpctvrgkavagrldelgaswslivaeetaeaare
    aaaaflrehpetdgilafndlmaagvlkalsgsgrrvpedcavigmdgiplgellspqls
    tmaldlrevgraavellvgllsgavtpgsqssrttlkhrlvlresteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rkqC (C:)
    artsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsgldavehlapqvda
    vigylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvavaqlmdskrqhiay
    leagsvpctvrgkavagrldelgaswslivaeetaeaareaaaaflrehpetdgilafnd
    lmaagvlkalsgsgrrvpedcavigmdgiplgellspqlstmaldlrevgraavellvgl
    lsgavtpgsqssrttlkhrlvlreste
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4rkqD (D:)
    mslsrfakglvqgartsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsg
    ldavehlapqvdavigylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvav
    aqlmdskrqhiayleagsasesdepvpctvrgkavagrldelgaswslivaeetaeaare
    aaaaflrehpetdgilafndlmaagvlkalsgsgrrvpedcavigmdgiplgellspqls
    tmaldlrevgraavellvgllsgavtpgsqssrttlkhrlvlresteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rkqD (D:)
    rtsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsgldavehlapqvdav
    igylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvavaqlmdskrqhiayl
    eagsasesdepvpctvrgkavagrldelgaswslivaeetaeaareaaaaflrehpetdg
    ilafndlmaagvlkalsgsgrrvpedcavigmdgiplgellspqlstmaldlrevgraav
    ellvgllsgavtpgsqssrttlkhrlvlreste