PDB entry 4rkl

View 4rkl on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V23T/V66T at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdtp, cavity, pressure
Deposited on 2014-10-13, released 2014-11-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.189
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • conflict (22)
      • conflict (43-44)
      • conflict (59)
      • conflict (110)
      • conflict (117)
      • conflict (121)
    Domains in SCOPe 2.05: d4rkla_
  • Heterogens: THP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4rklA (A:)
atstkklhkepatlikaidgdttklmykgqpmtfrlllvdtpefnekygpeasaftkkmt
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >4rklA (A:)
lhkepatlikaidgdttklmykgqpmtfrlllvdtpefnekygpeasaftkkmtenakki
evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws