PDB entry 4rkc

View 4rkc on RCSB PDB site
Description: Psychrophilic aromatic amino acids aminotransferase from Psychrobacter sp. B6
Class: transferase
Keywords: AMINOTRANSFERASE, AROMATIC SUBSTRATES, PLP Dependent ENZYME, PLP, TRANSFERASE
Deposited on 2014-10-12, released 2015-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aromatic amino acid aminotransferase
    Species: Psychrobacter sp. B6 [TaxId:408968]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rkca_
  • Chain 'B':
    Compound: aromatic amino acid aminotransferase
    Species: Psychrobacter sp. B6 [TaxId:408968]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rkcb_
  • Heterogens: MG, NO3, PMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkcA (A:)
    mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
    sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
    skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
    chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
    snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
    aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
    lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkcB (B:)
    mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
    sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
    skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
    chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
    snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
    aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
    lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd