PDB entry 4rk4

View 4rk4 on RCSB PDB site
Description: Crystal structure of LacI family transcriptional regulator from Lactobacillus casei, Target EFI-512911, with bound glucose
Class: transcription regulator
Keywords: sugar binding, transcription regulation, Enzyme Function Initiative, EFI, structural genomics, transcriptional factor, D-glucose, TRANSCRIPTION REGULATOR
Deposited on 2014-10-11, released 2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.126
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, LacI family
    Species: Lactobacillus casei ATCC 334 [TaxId:321967]
    Gene: LSEI_2103
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rk4a_
  • Heterogens: GLC, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rk4A (A:)
    qsmlraqatgnigvlvsrvtnpffaglfdaierelhahgyqvmitqtyddpeaeerflkq
    lksreldgvilasveapdrvmavakafpgrvvvvnadvqipgatslvlphyqatrdaldy
    lfnqghrrfayvsggtisgahhgqsrtqafldfmqahqllvaqdllfgqihtakegqavg
    kqlaslapnvrpdavftnsdevavgvidsllaadvkvpddiavmgyddqpfapfakiplt
    tvhqpvasmaaaathellkglgrqvaqdtqptlhlslkirqsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rk4A (A:)
    tgnigvlvsrvtnpffaglfdaierelhahgyqvmitqtyddpeaeerflkqlksreldg
    vilasveapdrvmavakafpgrvvvvnadvqipgatslvlphyqatrdaldylfnqghrr
    fayvsggtisgahhgqsrtqafldfmqahqllvaqdllfgqihtakegqavgkqlaslap
    nvrpdavftnsdevavgvidsllaadvkvpddiavmgyddqpfapfakiplttvhqpvas
    maaaathellkglgrqvaqlhlslkirqsa