PDB entry 4rjy

View 4rjy on RCSB PDB site
Description: Crystal structure of E. coli L-Threonine Aldolase in complex with a non-covalently uncleaved bound L-serine substrate
Class: lyase
Keywords: Pyridoxal-5-phosphate, threonine aldolase, aldimine, catalytic mechanism, retro-aldol cleavage, PLP-dependent enzymes, LYASE
Deposited on 2014-10-11, released 2014-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low specificity L-threonine aldolase
    Species: Escherichia coli [TaxId:1182686]
    Gene: A1UU_02790
    Database cross-references and differences (RAF-indexed):
    • Uniprot L4EJM2 (0-End)
      • conflict (157)
      • conflict (255)
    Domains in SCOPe 2.07: d4rjya_
  • Chain 'B':
    Compound: Low specificity L-threonine aldolase
    Species: Escherichia coli [TaxId:1182686]
    Gene: A1UU_02790
    Database cross-references and differences (RAF-indexed):
    • Uniprot L4EJM2 (0-End)
      • conflict (157)
      • conflict (255)
    Domains in SCOPe 2.07: d4rjyb_
  • Chain 'C':
    Compound: Low specificity L-threonine aldolase
    Species: Escherichia coli [TaxId:1182686]
    Gene: A1UU_02790
    Database cross-references and differences (RAF-indexed):
    • Uniprot L4EJM2 (0-End)
      • conflict (157)
      • conflict (255)
    Domains in SCOPe 2.07: d4rjyc_
  • Chain 'D':
    Compound: Low specificity L-threonine aldolase
    Species: Escherichia coli [TaxId:1182686]
    Gene: A1UU_02790
    Database cross-references and differences (RAF-indexed):
    • Uniprot L4EJM2 (0-End)
      • conflict (157)
      • conflict (255)
    Domains in SCOPe 2.07: d4rjyd_
  • Heterogens: NA, SER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rjyA (A:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
    alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsraqlaevaahwraflar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rjyA (A:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
    alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsraqlaevaahwrafla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rjyB (B:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
    alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsraqlaevaahwraflar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rjyB (B:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
    alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsraqlaevaahwrafla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rjyC (C:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
    alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsraqlaevaahwraflar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rjyC (C:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
    alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsraqlaevaahwrafla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4rjyD (D:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
    alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsraqlaevaahwraflar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rjyD (D:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
    alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsraqlaevaahwrafla