PDB entry 4rj6

View 4rj6 on RCSB PDB site
Description: EGFR kinase (T790M/L858R) with inhibitor compound 4
Class: Transferase/Transferase inhibitor
Keywords: protein kinase, phosphotransfer catalyst, Transferase-Transferase inhibitor complex
Deposited on 2014-10-08, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (96)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4rj6a_
  • Heterogens: SO4, 3R0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rj6A (A:)
    gsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatsp
    kankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqy
    llnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaaaaeyhaeg
    gkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerl
    pqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspt
    dsnfyralmdeedmddvvdadeylipqqgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rj6A (A:)
    eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaiketspkankeil
    deayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvq
    iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgraklvpikwmalesilhriythq
    sdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmid
    adsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfydmddvvdadeyli