PDB entry 4rix

View 4rix on RCSB PDB site
Description: Crystal structure of an EGFR/HER3 kinase domain heterodimer containing the cancer-associated HER3-Q790R mutation
Class: transferase
Keywords: receptor tyrosine kinase, pseudokinase, kinase, ATP binding, membrane, transferase
Deposited on 2014-10-07, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.21
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor tyrosine-protein kinase erbB-3
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB3, HER3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21860
      • engineered mutation (114)
    Domains in SCOPe 2.07: d4rixa_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (270)
    Domains in SCOPe 2.07: d4rixb_
  • Chain 'C':
    Compound: Receptor tyrosine-protein kinase erbB-3
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB3, HER3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21860
      • engineered mutation (114)
    Domains in SCOPe 2.07: d4rixc_
  • Chain 'D':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (270)
    Domains in SCOPe 2.07: d4rixd_
  • Heterogens: ANP, MG, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rixA (A:)
    gagkvlarifketelrklkvlgsgvfgtvhkgvwipegesikipvcikviedksgrqsfq
    avtdhmlaigsldhahivrllglcpgsslqlvtqylplgslldhvrqhrgalgprlllnw
    gvqiakgmyyleehgmvhrnlaarnvllkspsqvqvadfgvadllppddkqllyseaktp
    ikwmalesihfgkythqsdvwsygvtvwelmtfgaepyaglrlaevpdllekgerlaqpq
    ictidvymvmvkcwmidenirptfkelaneftrmardpprylvikresgpgiapgpephg
    ltnkkleevelepeldldldleaeed
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rixA (A:)
    vlarifketelrklkvlgsgvfgtvhkgvwipegesikipvcikviedksgrqsfqavtd
    hmlaigsldhahivrllglcpgsslqlvtqylplgslldhvrqhrgalgprlllnwgvqi
    akgmyyleehgmvhrnlaarnvllkspsqvqvadfgvadllpppikwmalesihfgkyth
    qsdvwsygvtvwelmtfgaepyaglrlaevpdllekgerlaqpqictidvymvmvkcwmi
    denirptfkelaneftrmardpprylvik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rixB (B:)
    gamgllqerelvepltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegek
    vkipvaikelreatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgc
    lldyvrehkdnigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfg
    lakllgaeekeyhaeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydg
    ipaseissilekgerlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqr
    ylviqgdermhlpsptdsnayraamdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rixB (B:)
    lvepltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikel
    reatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkd
    nigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeek
    eyhavpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rixC (C:)
    gagkvlarifketelrklkvlgsgvfgtvhkgvwipegesikipvcikviedksgrqsfq
    avtdhmlaigsldhahivrllglcpgsslqlvtqylplgslldhvrqhrgalgprlllnw
    gvqiakgmyyleehgmvhrnlaarnvllkspsqvqvadfgvadllppddkqllyseaktp
    ikwmalesihfgkythqsdvwsygvtvwelmtfgaepyaglrlaevpdllekgerlaqpq
    ictidvymvmvkcwmidenirptfkelaneftrmardpprylvikresgpgiapgpephg
    ltnkkleevelepeldldldleaeed
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rixC (C:)
    vlarifketelrklkvlgsgvfgtvhkgvwipegesikipvcikviesfqavtdhmlaig
    sldhahivrllglcpgsslqlvtqylplgslldhvrqhrgalgprlllnwgvqiakgmyy
    leehgmvhrnlaarnvllkspsqvqvadfgvadllppddkqllyseaktpikwmalesih
    fgkythqsdvwsygvtvwelmtfgaepyaglrlaevpdllekgerlaqpqictidvymvm
    vkcwmidenirptfkelaneftrmardpprylvik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4rixD (D:)
    gamgllqerelvepltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegek
    vkipvaikelreatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgc
    lldyvrehkdnigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfg
    lakllgaeekeyhaeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydg
    ipaseissilekgerlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqr
    ylviqgdermhlpsptdsnayraamdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rixD (D:)
    lvepltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikel
    reatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkd
    nigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeek
    eyhaeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissil
    ekgerlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgd