PDB entry 4rhn

View 4rhn on RCSB PDB site
Description: histidine triad nucleotide-binding protein (hint) from rabbit complexed with adenosine
Class: nucleotide-binding protein
Keywords: nucleotide-binding protein
Deposited on 1997-02-26, released 1997-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine triad nucleotide-binding protein
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: HINT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rhna_
  • Heterogens: RIB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rhnA (A:)
    rpggdtifgkiirkeipakiifeddqclafhdispqapthflvipkkhisqisaaedade
    sllghlmivgkkcaadlglkkgyrmvvnegsdggqsvyhvhlhvlggrqmnwppg