PDB entry 4rgo

View 4rgo on RCSB PDB site
Description: Structure of Staphylococcal Enterotoxin B bound to the neutralizing antibody 14G8
Class: toxin/immune system
Keywords: Neutralizing antibody, Staphylococcal enterotoxin B, TOXIN-IMMUNE SYSTEM complex
Deposited on 2014-09-30, released 2015-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 14G8 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4RGO (0-End)
  • Chain 'L':
    Compound: 14G8 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4RGO (0-End)
    Domains in SCOPe 2.07: d4rgol1, d4rgol2
  • Chain 'S':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rgos1, d4rgos2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4rgoL (L:)
    divmtqspatlsvtpgdrvslscrasqsigdylhwyqqkshesprllinyasqsisgips
    rfsgsgsgsdftliinsvepedvgvyycqnghsfpytfgggtkleirradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rgoL (L:)
    divmtqspatlsvtpgdrvslscrasqsigdylhwyqqkshesprllinyasqsisgips
    rfsgsgsgsdftliinsvepedvgvyycqnghsfpytfgggtkleirradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4rgoS (S:)
    gsefgsesqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysik
    dtklgnydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcm
    yggvtehngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkkl
    yefnnspyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyl
    ttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rgoS (S:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfskrktcmyggvtehngnqldkyrsit
    vrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfiene
    nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk