PDB entry 4rgn

View 4rgn on RCSB PDB site
Description: Structure of Staphylococcal Enterotoxin B bound to two neutralizing antibodies, 14G8 and 6D3
Class: toxin/immune system
Keywords: Neutralizing antibody, Staphylococcal enterotoxin B, TOXIN-IMMUNE SYSTEM complex
Deposited on 2014-09-30, released 2015-01-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rgna1, d4rgna2
  • Chain 'B':
    Compound: 14G8 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RGN (0-End)
  • Chain 'C':
    Compound: 14G8 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RGN (0-End)
    Domains in SCOPe 2.06: d4rgnc1, d4rgnc2
  • Chain 'D':
    Compound: 6D3 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RGN
  • Chain 'E':
    Compound: 6D3 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RGN (0-219)
    Domains in SCOPe 2.06: d4rgne1, d4rgne2
  • Chain 'F':
    Compound: 6D3 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RGN
  • Chain 'G':
    Compound: 6D3 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RGN (0-219)
    Domains in SCOPe 2.06: d4rgng1, d4rgng2
  • Chain 'H':
    Compound: 14G8 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RGN (0-End)
  • Chain 'L':
    Compound: 14G8 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RGN (0-End)
    Domains in SCOPe 2.06: d4rgnl1, d4rgnl2
  • Chain 'S':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rgns1, d4rgns2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rgnA (A:)
    gsefgsesqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysik
    dtklgnydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcm
    yggvtehngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkkl
    yefnnspyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyl
    ttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rgnA (A:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysidnvrvefk
    nkdladkykdkyvdvfganyyyqcyfsktcmyggvtehngnqldkyrsitvrvfedgknl
    lsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfienensfwydmmpa
    pgdkfdqskylmmyndnkmvdskdvkievylttk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rgnC (C:)
    divmtqspatlsvtpgdrvslscrasqsigdylhwyqqkshesprllinyasqsisgips
    rfsgsgsgsdftliinsvepedvgvyycqnghsfpytfgggtkleirradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rgnC (C:)
    divmtqspatlsvtpgdrvslscrasqsigdylhwyqqkshesprllinyasqsisgips
    rfsgsgsgsdftliinsvepedvgvyycqnghsfpytfgggtkleirradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rgnE (E:)
    divmtqspssltvtagekvtmtckssqslfnsgnqknfltwyqqipgqppklliywastr
    dsgvpdrftgsgsgtdftltissvqaedlavyycqndytypltfgvgtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqdgvldswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rgnG (G:)
    divmtqspssltvtagekvtmtckssqslfnsgnqknfltwyqqipgqppklliywastr
    dsgvpdrftgsgsgtdftltissvqaedlavyycqndytypltfgvgtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqdgvldswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4rgnL (L:)
    divmtqspatlsvtpgdrvslscrasqsigdylhwyqqkshesprllinyasqsisgips
    rfsgsgsgsdftliinsvepedvgvyycqnghsfpytfgggtkleirradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rgnL (L:)
    divmtqspatlsvtpgdrvslscrasqsigdylhwyqqkshesprllinyasqsisgips
    rfsgsgsgsdftliinsvepedvgvyycqnghsfpytfgggtkleirradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4rgnS (S:)
    gsefgsesqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysik
    dtklgnydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcm
    yggvtehngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkkl
    yefnnspyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyl
    ttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rgnS (S:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtkdnvr
    vefknkdladkykdkyvdvfganyyyqcyfsrktcmyggvtehngnqldkyrsitvrvfe
    dgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfienensfwy
    dmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk