PDB entry 4rgd

View 4rgd on RCSB PDB site
Description: The structure a AS-48 G13K/L40K mutant
Class: antibiotic
Keywords: Circular Bacteriocin, membrane interaction, plasma membrane, ANTIBIOTIC
Deposited on 2014-09-29, released 2015-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriocin as-48
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: as-48, as48A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47765 (0-69)
      • engineered mutation (12)
      • engineered mutation (39)
    Domains in SCOPe 2.08: d4rgda_
  • Chain 'B':
    Compound: bacteriocin as-48
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: as-48, as48A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47765 (0-69)
      • engineered mutation (12)
      • engineered mutation (39)
    Domains in SCOPe 2.08: d4rgdb_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rgdA (A:)
makefgipaavaktvlnvveaggwvttivsiltavgsggksllaaagresikaylkkeik
kkgkraviaw

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rgdB (B:)
makefgipaavaktvlnvveaggwvttivsiltavgsggksllaaagresikaylkkeik
kkgkraviaw