PDB entry 4rfr

View 4rfr on RCSB PDB site
Description: Complex structure of AlkB/rhein
Class: oxidoreductase/inhibitor
Keywords: protein-inhibitor complex, demethylation, AlkB family, Jellyroll Fold, demethylase, nucleic acid binding, nucleus, OXIDOREDUCTASE-INHIBITOR complex
Deposited on 2014-09-27, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Alpha-ketoglutarate-dependent dioxygenase AlkB
    Species: Escherichia coli [TaxId:562]
    Gene: alkB, aidD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rfrb_
  • Heterogens: RHN, MN, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rfrB (B:)
    plaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthr
    qgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqd
    kdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplk
    agfhpltidcrynltfrqagkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rfrB (B:)
    plaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthr
    qgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqd
    kdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplk
    agfhpltidcrynltfrqagk