PDB entry 4rf5

View 4rf5 on RCSB PDB site
Description: Crystal structure of ketoreductase from Lactobacillus kefir, E145S mutant
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2014-09-24, released 2015-09-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADPH dependent R-specific alcohol dehydrogenase
    Species: Lactobacillus kefiri [TaxId:33962]
    Gene: adhR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WVP7 (Start-271)
      • engineered mutation (164)
    Domains in SCOPe 2.05: d4rf5a_
  • Chain 'B':
    Compound: NADPH dependent R-specific alcohol dehydrogenase
    Species: Lactobacillus kefiri [TaxId:33962]
    Gene: adhR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WVP7 (Start-271)
      • engineered mutation (164)
    Domains in SCOPe 2.05: d4rf5b_
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rf5A (A:)
    hhhhhhhhgglvprgshggsmtdrlkgkvaivtggtlgiglaiadkfveegakvvitgrh
    advgekaaksiggtdvirfvqhdasdeagwtklfdtteeafgpvttvvnnagiavsksve
    dttteewrkllsvnldgvffgtrlgiqrmknkglgasiinmssisgfvgdptlgaynask
    gavrimsksaaldcalkdydvrvntvhpgyiktplvddlegaeemmsqrtktpmghigep
    ndiawicvylasdeskfatgaefvvdggytaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rf5A (A:)
    tdrlkgkvaivtggtlgiglaiadkfveegakvvitgrhadvgekaaksiggtdvirfvq
    hdasdeagwtklfdtteeafgpvttvvnnagiavsksvedttteewrkllsvnldgvffg
    trlgiqrmknkglgasiinmssisgfvgdptlgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlegaeemmsqrtktpmghigepndiawicvylasdeskfatga
    efvvdggytaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rf5B (B:)
    hhhhhhhhgglvprgshggsmtdrlkgkvaivtggtlgiglaiadkfveegakvvitgrh
    advgekaaksiggtdvirfvqhdasdeagwtklfdtteeafgpvttvvnnagiavsksve
    dttteewrkllsvnldgvffgtrlgiqrmknkglgasiinmssisgfvgdptlgaynask
    gavrimsksaaldcalkdydvrvntvhpgyiktplvddlegaeemmsqrtktpmghigep
    ndiawicvylasdeskfatgaefvvdggytaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rf5B (B:)
    tdrlkgkvaivtggtlgiglaiadkfveegakvvitgrhadvgekaaksiggtdvirfvq
    hdasdeagwtklfdtteeafgpvttvvnnagiavsksvedttteewrkllsvnldgvffg
    trlgiqrmknkglgasiinmssisgfvgdptlgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlegaeemmsqrtktpmghigepndiawicvylasdeskfatga
    efvvdggytaq