PDB entry 4rf3

View 4rf3 on RCSB PDB site
Description: Crystal Structure of ketoreductase from Lactobacillus kefir, mutant A94F
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2014-09-24, released 2015-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-06, with a file datestamp of 2015-12-31.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADPH dependent R-specific alcohol dehydrogenase
    Species: Lactobacillus kefiri [TaxId:33962]
    Gene: adhR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WVP7 (Start-271)
      • engineered mutation (113)
    Domains in SCOPe 2.07: d4rf3a_
  • Chain 'B':
    Compound: NADPH dependent R-specific alcohol dehydrogenase
    Species: Lactobacillus kefiri [TaxId:33962]
    Gene: adhR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WVP7 (Start-271)
      • engineered mutation (113)
    Domains in SCOPe 2.07: d4rf3b_
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rf3A (A:)
    hhhhhhhhgglvprgshggsmtdrlkgkvaivtggtlgiglaiadkfveegakvvitgrh
    advgekaaksiggtdvirfvqhdasdeagwtklfdtteeafgpvttvvnnagifvsksve
    dttteewrkllsvnldgvffgtrlgiqrmknkglgasiinmssiegfvgdptlgaynask
    gavrimsksaaldcalkdydvrvntvhpgyiktplvddlegaeemmsqrtktpmghigep
    ndiawicvylasdeskfatgaefvvdggytaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rf3A (A:)
    tdrlkgkvaivtggtlgiglaiadkfveegakvvitgrhadvgekaaksiggtdvirfvq
    hdasdeagwtklfdtteeafgpvttvvnnagifvsksvedttteewrkllsvnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdptlgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlegaeemmsqrtktpmghigepndiawicvylasdeskfatga
    efvvdggytaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rf3B (B:)
    hhhhhhhhgglvprgshggsmtdrlkgkvaivtggtlgiglaiadkfveegakvvitgrh
    advgekaaksiggtdvirfvqhdasdeagwtklfdtteeafgpvttvvnnagifvsksve
    dttteewrkllsvnldgvffgtrlgiqrmknkglgasiinmssiegfvgdptlgaynask
    gavrimsksaaldcalkdydvrvntvhpgyiktplvddlegaeemmsqrtktpmghigep
    ndiawicvylasdeskfatgaefvvdggytaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rf3B (B:)
    drlkgkvaivtggtlgiglaiadkfveegakvvitgrhadvgekaaksiggtdvirfvqh
    dasdeagwtklfdtteeafgpvttvvnnagifvsksvedttteewrkllsvnldgvffgt
    rlgiqrmknkglgasiinmssiegfvgdptlgaynaskgavrimsksaaldcalkdydvr
    vntvhpgyiktplvddlegaeemmsqrtktpmghigepndiawicvylasdeskfatgae
    fvvdggytaq