PDB entry 4rex

View 4rex on RCSB PDB site
Description: Crystal structure of the first WW domain of human YAP2 isoform
Class: protein binding
Keywords: WW domain, Hippo signaling pathway, antiparallel beta-sheet, protein binding, proline rich motifs
Deposited on 2014-09-24, released 2015-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Yorkie homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: YAP1, YAP65
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46937 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d4rexa1, d4rexa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rexA (A:)
    gamgfeipddvplpagwemaktssgqryflnhidqtttwqdprkamlsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rexA (A:)
    gamgfeipddvplpagwemaktssgqryflnhidqtttwqdprkamls