PDB entry 4rdu
View 4rdu on RCSB PDB site
Description: Crystal structure of a distal-less homeobox protein 5 (Dlx5) from Homo sapiens at 1.85 A resolution
Class: transcription/DNA
Keywords: PF00046 family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, TRANSCRIPTION, TRANSCRIPTION-DNA complex, Partnership for Stem Cell Biology, STEMCELL
Deposited on
2014-09-19, released
2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-11-22, with a file datestamp of
2017-11-17.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Homeobox protein DLX-5
Species: Homo sapiens [TaxId:9606]
Gene: BC006226, DLX5
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4rdua_ - Chain 'B':
Compound: (dc)(dg)(da)(dc)(dt)(da)(da)(dt)(dt)(da)(dg)(dt)(dc)(dg)
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'C':
Compound: (dc)(dg)(da)(dc)(dt)(da)(da)(dt)(dt)(da)(dg)(dt)(dc)(dg)
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'D':
Compound: Homeobox protein DLX-5
Species: Homo sapiens [TaxId:9606]
Gene: BC006226, DLX5
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4rdud_ - Chain 'E':
Compound: (dc)(dg)(da)(dc)(dt)(da)(da)(dt)(dt)(da)(dg)(dt)(dc)(dg)
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'F':
Compound: (dc)(dg)(da)(dc)(dt)(da)(da)(dt)(dt)(da)(dg)(dt)(dc)(dg)
Species: synthetic construct, synthetic [TaxId:32630]
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4rduA (A:)
ghmvrkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrskik
kimkn
Sequence, based on observed residues (ATOM records): (download)
>4rduA (A:)
rkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrskikkimk
n
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>4rduD (D:)
ghmvrkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrskik
kimkn
Sequence, based on observed residues (ATOM records): (download)
>4rduD (D:)
vrkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrskikkim
kn
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.