PDB entry 4rdu

View 4rdu on RCSB PDB site
Description: Crystal structure of a distal-less homeobox protein 5 (Dlx5) from Homo sapiens at 1.85 A resolution
Class: transcription/DNA
Keywords: PF00046 family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, TRANSCRIPTION, TRANSCRIPTION-DNA complex, Partnership for Stem Cell Biology, STEMCELL
Deposited on 2014-09-19, released 2014-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein DLX-5
    Species: Homo sapiens [TaxId:9606]
    Gene: BC006226, DLX5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4rdua_
  • Chain 'B':
    Compound: (dc)(dg)(da)(dc)(dt)(da)(da)(dt)(dt)(da)(dg)(dt)(dc)(dg)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'C':
    Compound: (dc)(dg)(da)(dc)(dt)(da)(da)(dt)(dt)(da)(dg)(dt)(dc)(dg)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: Homeobox protein DLX-5
    Species: Homo sapiens [TaxId:9606]
    Gene: BC006226, DLX5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4rdud_
  • Chain 'E':
    Compound: (dc)(dg)(da)(dc)(dt)(da)(da)(dt)(dt)(da)(dg)(dt)(dc)(dg)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'F':
    Compound: (dc)(dg)(da)(dc)(dt)(da)(da)(dt)(dt)(da)(dg)(dt)(dc)(dg)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rduA (A:)
    ghmvrkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrskik
    kimkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rduA (A:)
    rkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrskikkimk
    n
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4rduD (D:)
    ghmvrkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrskik
    kimkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rduD (D:)
    vrkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrskikkim
    kn
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.