PDB entry 4rdq

View 4rdq on RCSB PDB site
Description: Calcium-activated chloride channel bestrophin-1, from chicken, in complex with Fab antibody fragments, chloride and calcium
Class: transport protein
Keywords: transmembrane protein, membrane protein, ion channel, calcium-activated chloride channel, CaCC, anion channel, membrane, TRANSPORT PROTEIN
Deposited on 2014-09-19, released 2014-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.218
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bestrophin-1
    Species: Gallus gallus [TaxId:9031]
    Gene: Best1 bestrophin-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bestrophin-1
    Species: Gallus gallus [TaxId:9031]
    Gene: Best1 bestrophin-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Bestrophin-1
    Species: Gallus gallus [TaxId:9031]
    Gene: Best1 bestrophin-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Bestrophin-1
    Species: Gallus gallus [TaxId:9031]
    Gene: Best1 bestrophin-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Bestrophin-1
    Species: Gallus gallus [TaxId:9031]
    Gene: Best1 bestrophin-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Fab antibody fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RDQ (0-211)
    Domains in SCOPe 2.07: d4rdqf1, d4rdqf2
  • Chain 'G':
    Compound: Fab antibody fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RDQ (0-216)
  • Chain 'H':
    Compound: Fab antibody fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RDQ (0-211)
    Domains in SCOPe 2.07: d4rdqh1, d4rdqh2
  • Chain 'I':
    Compound: Fab antibody fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RDQ (0-216)
  • Chain 'J':
    Compound: Fab antibody fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RDQ (0-211)
    Domains in SCOPe 2.07: d4rdqj1, d4rdqj2
  • Chain 'K':
    Compound: Fab antibody fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RDQ (0-216)
  • Chain 'L':
    Compound: Fab antibody fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RDQ (0-211)
    Domains in SCOPe 2.07: d4rdql1, d4rdql2
  • Chain 'M':
    Compound: Fab antibody fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RDQ (0-216)
  • Chain 'N':
    Compound: Fab antibody fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RDQ (0-211)
    Domains in SCOPe 2.07: d4rdqn1, d4rdqn2
  • Chain 'O':
    Compound: Fab antibody fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RDQ (0-216)
  • Heterogens: GOL, CL, CA, K, C6N, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rdqF (F:)
    diqmtqspaslsasvgetvtitcraseniysyltwyqqkqgkspqllvynaktltegvps
    rfsgsgsgtqfslkinslqpedfggyfcqhhygtpptfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rdqH (H:)
    diqmtqspaslsasvgetvtitcraseniysyltwyqqkqgkspqllvynaktltegvps
    rfsgsgsgtqfslkinslqpedfggyfcqhhygtpptfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rdqJ (J:)
    diqmtqspaslsasvgetvtitcraseniysyltwyqqkqgkspqllvynaktltegvps
    rfsgsgsgtqfslkinslqpedfggyfcqhhygtpptfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rdqL (L:)
    diqmtqspaslsasvgetvtitcraseniysyltwyqqkqgkspqllvynaktltegvps
    rfsgsgsgtqfslkinslqpedfggyfcqhhygtpptfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rdqN (N:)
    diqmtqspaslsasvgetvtitcraseniysyltwyqqkqgkspqllvynaktltegvps
    rfsgsgsgtqfslkinslqpedfggyfcqhhygtpptfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'O':
    No sequence available.